SLC43A2 antibody (N-Term)

Catalog No. ABIN634843

This Rabbit Polyclonal antibody specifically detects SLC43A2 in WB. It exhibits reactivity toward Human.

Quick Overview for SLC43A2 antibody (N-Term) (ABIN634843)

Target: SLC43A2 (Solute Carrier Family 43, Member 2 (SLC43A2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC43A2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC43A2 Antibody

Binding Specificity: N-Term

Specificity: SLC43 A2 antibody was raised against the N terminal of SLC43 2

Purification: Affinity purified

Immunogen: SLC43 A2 antibody was raised using the N terminal of SLC43 2 corresponding to a region with amino acids TEPENVTNGTVGGTAEPGHEEVSWMNGWLSCQAQDEMLNLAFTVGSFLLS

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC43A2 Blocking Peptide, (ABIN5616255), is also available for use as a blocking control in assays to test for specificity of this SLC43A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC43A2

Target: SLC43A2 (Solute Carrier Family 43, Member 2 (SLC43A2))

Alternative Name: SLC43A2

Background: SLC43A2 is a Sodium-, chloride, pH-independent high affinity transport of large neutral amino acids.

Molecular Weight: 53 kDa (MW of target protein)