TMEM135 antibody (N-Term)

Catalog No. ABIN634847

The Rabbit Polyclonal anti-TMEM135 antibody has been validated for WB. It is suitable to detect TMEM135 in samples from Human.

Quick Overview for TMEM135 antibody (N-Term) (ABIN634847)

Target: TMEM135 (Transmembrane Protein 135 (TMEM135))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM135 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM135 Antibody

Binding Specificity: N-Term

Specificity: TMEM135 antibody was raised against the N terminal of TMEM135

Purification: Affinity purified

Immunogen: TMEM135 antibody was raised using the N terminal of TMEM135 corresponding to a region with amino acids SLKIYAPLYLIAAILRKRKLDYYLHKLLPEILQSASFLTANGALYMAFFC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM135 Blocking Peptide, (ABIN5616662), is also available for use as a blocking control in assays to test for specificity of this TMEM135 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM135 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM135

Target: TMEM135 (Transmembrane Protein 135 (TMEM135))

Alternative Name: TMEM135

Background: TMEM135 protein is part of a conserved genetic network involved in fat storage and longevity regulation.

Molecular Weight: 52 kDa (MW of target protein)