PARP16 antibody

Catalog No. ABIN634849

This Rabbit Polyclonal antibody specifically detects PARP16 in WB. It exhibits reactivity toward Human.

Quick Overview for PARP16 antibody (ABIN634849)

Target: PARP16 (Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARP16 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PARP16 Antibody

Purification: Affinity purified

Immunogen: PARP16 antibody was raised using a synthetic peptide corresponding to a region with amino acids KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWD

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARP16 Blocking Peptide, (ABIN940006), is also available for use as a blocking control in assays to test for specificity of this PARP16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARP16

Target: PARP16 (Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16))

Alternative Name: PARP16

Background: Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks.

Molecular Weight: 36 kDa (MW of target protein)