ABCF3 antibody

Catalog No. ABIN634851

This anti-ABCF3 antibody is a Rabbit Polyclonal antibody detecting ABCF3 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for ABCF3 antibody (ABIN634851)

Target: ABCF3 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCF3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ABCF3 Antibody

Purification: Affinity purified

Immunogen: ABCF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLVEAVGELLQEVSGDSKDDAGIRAVCQRMYNTLRLAEPQSQGNSQVLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCF3 Blocking Peptide, (ABIN937269), is also available for use as a blocking control in assays to test for specificity of this ABCF3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCF3

Target: ABCF3 (ATP-Binding Cassette, Sub-Family F (GCN20), Member 3 (ABCF3))

Alternative Name: ABCF3

Background: ABCF3 belongs to the ABC transporter family, EF3 subfamily. It contains 2 ABC transporter domains. The exact function of ABCF3 remains unknown.

Molecular Weight: 78 kDa (MW of target protein)