SLC23A2 antibody

Catalog No. ABIN634854

This anti-SLC23A2 antibody is a Rabbit Polyclonal antibody detecting SLC23A2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for SLC23A2 antibody (ABIN634854)

Target: SLC23A2 (Solute Carrier Family 23 (Nucleobase Transporters), Member 2 (SLC23A2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC23A2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC23A2 Antibody

Purification: Affinity purified

Immunogen: SLC23 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids VALIGLSGFQAAGERAGKHWGIAMLTIFLVLLFSQYARNVKFPLPIYKSK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC23A2 Blocking Peptide, (ABIN5616205), is also available for use as a blocking control in assays to test for specificity of this SLC23A2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC23A2

Target: SLC23A2 (Solute Carrier Family 23 (Nucleobase Transporters), Member 2 (SLC23A2))

Alternative Name: SLC23A2

Background: The absorption of vitamin C into the body and its distribution to organs requires two sodium-dependent vitamin C transporters. This gene encodes one of the two required transporters and the encoded protein accounts for tissue-specific uptake of vitamin C. Previously, this gene had an official symbol of SLC23A1.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development