AREL1 antibody (Middle Region)

Catalog No. ABIN634861

This Rabbit Polyclonal antibody specifically detects AREL1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for AREL1 antibody (Middle Region) (ABIN634861)

Target: AREL1 (Apoptosis Resistant E3 Ubiquitin Protein Ligase 1 (AREL1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AREL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AREL1 Antibody

Binding Specificity: Middle Region

Specificity: KIAA0317 antibody was raised against the middle region of KIAA0317

Purification: Affinity purified

Immunogen: KIAA0317 antibody was raised using the middle region of KIAA0317 corresponding to a region with amino acids VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILNNDMSEMELVF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIAA0317 Blocking Peptide, catalog no. 33R-9768, is also available for use as a blocking control in assays to test for specificity of this KIAA0317 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0317 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AREL1

Target: AREL1 (Apoptosis Resistant E3 Ubiquitin Protein Ligase 1 (AREL1))

Alternative Name: KIAA0317

Background: KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.

Molecular Weight: 94 kDa (MW of target protein)