ABCD4 antibody

Catalog No. ABIN634864

This Rabbit Polyclonal antibody specifically detects ABCD4 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ABCD4 antibody (ABIN634864)

Target: ABCD4 (ATP-Binding Cassette, Sub-Family D (Ald), Member 4 (ABCD4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCD4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ABCD4 Antibody

Purification: Affinity purified

Immunogen: ABCD4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCD4 Blocking Peptide, (ABIN936267), is also available for use as a blocking control in assays to test for specificity of this ABCD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCD4

Target: ABCD4 (ATP-Binding Cassette, Sub-Family D (Ald), Member 4 (ABCD4))

Alternative Name: ABCD4

Background: ABCD4 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown.

Molecular Weight: 68 kDa (MW of target protein)