SLC22A14 antibody (N-Term)

Catalog No. ABIN634865

Product Details anti-SLC22A14 Antibody

Target: SLC22A14 (Solute Carrier Family 22 (Organic Cation Transporter), Member 14 (SLC22A14))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC22A14 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC22 A14 antibody was raised against the N terminal of SLC22 14

Purification: Affinity purified

Immunogen: SLC22 A14 antibody was raised using the N terminal of SLC22 14 corresponding to a region with amino acids IIQFGLNDTDTCQDGWIYPDAKKRSLINEFDLVCGMETKKDTAQIMFMAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC22A14 Blocking Peptide, catalog no. 33R-4005, is also available for use as a blocking control in assays to test for specificity of this SLC22A14 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC22A14

Target: SLC22A14 (Solute Carrier Family 22 (Organic Cation Transporter), Member 14 (SLC22A14))

Alternative Name: SLC22A14 (SLC22A14 Products)

Background: SLC22A14 is a member of the organic-cation transporter family. SLC22A14 is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems.

Molecular Weight: 67 kDa (MW of target protein)