KLHL31 antibody

Catalog No. ABIN634869

This anti-KLHL31 antibody is a Rabbit Polyclonal antibody detecting KLHL31 in WB and IHC. Suitable for Mouse, Human, Dog and Rat.

Quick Overview for KLHL31 antibody (ABIN634869)

Target: KLHL31 (Kelch-Like 31 (KLHL31))

Reactivity: Mouse, Human, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KLHL31 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-KLHL31 Antibody

Purification: Affinity purified

Immunogen: KLHL31 antibody was raised using a synthetic peptide corresponding to a region with amino acids TPRGWHCAVTLSDRVYVMGGSQLGPRGERVDVLTVECYSPATGQWSYAAP

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KLHL31 Blocking Peptide, (ABIN5614381), is also available for use as a blocking control in assays to test for specificity of this KLHL31 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KLHL31

Target: KLHL31 (Kelch-Like 31 (KLHL31))

Alternative Name: KLHL31

Background: KLHL31 is a transcriptional repressor in MAPK/JNK signaling pathway to regulate cellular functions. Overexpression inhibits the transcriptional activities of both the TPA-response element (TRE) and serum response element (SRE)

Molecular Weight: 70 kDa (MW of target protein)