Thymopoietin antibody (N-Term)

Catalog No. ABIN634870

This Rabbit Polyclonal antibody specifically detects Thymopoietin in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for Thymopoietin antibody (N-Term) (ABIN634870)

Target: Thymopoietin (TMPO)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Thymopoietin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Thymopoietin Antibody

Binding Specificity: N-Term

Specificity: Thymopoietin antibody was raised against the N terminal of TMPO

Purification: Affinity purified

Immunogen: Thymopoietin antibody was raised using the N terminal of TMPO corresponding to a region with amino acids MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Thymopoietin Blocking Peptide, (ABIN5616594), is also available for use as a blocking control in assays to test for specificity of this Thymopoietin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Thymopoietin

Target: Thymopoietin (TMPO)

Alternative Name: Thymopoietin

Background: TMPO may be involved in the structural organization of the nucleus and in the post-mitotic nuclear assembly. It plays an important role, together with LMNA, in the nuclear anchorage of RB1.

Molecular Weight: 39 kDa (MW of target protein)