ENTPD7 antibody (C-Term)

Catalog No. ABIN634874

The Rabbit Polyclonal anti-ENTPD7 antibody has been validated for WB. It is suitable to detect ENTPD7 in samples from Human.

Quick Overview for ENTPD7 antibody (C-Term) (ABIN634874)

Target: ENTPD7 (Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ENTPD7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ENTPD7 Antibody

Binding Specificity: C-Term

Specificity: ENTPD7 antibody was raised against the C terminal of ENTPD7

Purification: Affinity purified

Immunogen: ENTPD7 antibody was raised using the C terminal of ENTPD7 corresponding to a region with amino acids EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ENTPD7 Blocking Peptide, (ABIN937845), is also available for use as a blocking control in assays to test for specificity of this ENTPD7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENTPD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ENTPD7

Target: ENTPD7 (Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7))

Alternative Name: ENTPD7

Background: ENTPD7 is a multi-pass membrane protein.It belongs to the GDA1/CD39 NTPase family. It preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP.

Molecular Weight: 69 kDa (MW of target protein)