GPR75 antibody (Middle Region)

Catalog No. ABIN634877

The Rabbit Polyclonal anti-GPR75 antibody is suitable to detect GPR75 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for GPR75 antibody (Middle Region) (ABIN634877)

Target: GPR75 (G Protein-Coupled Receptor 75 (GPR75))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GPR75 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GPR75 Antibody

Binding Specificity: Middle Region

Specificity: GPR75 antibody was raised against the middle region of GPR75

Purification: Affinity purified

Immunogen: GPR75 antibody was raised using the middle region of GPR75 corresponding to a region with amino acids GQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GPR75 Blocking Peptide, (ABIN938899), is also available for use as a blocking control in assays to test for specificity of this GPR75 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR75 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GPR75

Target: GPR75 (G Protein-Coupled Receptor 75 (GPR75))

Alternative Name: GPR75

Background: GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.GPR75 is a member of the G protein-coupled receptor family. GPRs are cell surface receptors that activate guanine-nucleotide binding proteins upon the binding of a ligand.

Molecular Weight: 59 kDa (MW of target protein)