LEMD2 antibody (Middle Region)

Catalog No. ABIN634879

This Rabbit Polyclonal antibody specifically detects LEMD2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for LEMD2 antibody (Middle Region) (ABIN634879)

Target: LEMD2 (LEM Domain Containing 2 (LEMD2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LEMD2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LEMD2 Antibody

Binding Specificity: Middle Region

Specificity: LEMD2 antibody was raised against the middle region of LEMD2

Purification: Affinity purified

Immunogen: LEMD2 antibody was raised using the middle region of LEMD2 corresponding to a region with amino acids QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LEMD2 Blocking Peptide, (ABIN5614441), is also available for use as a blocking control in assays to test for specificity of this LEMD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEMD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LEMD2

Target: LEMD2 (LEM Domain Containing 2 (LEMD2))

Alternative Name: LEMD2

Background: LEMD2 is involved in nuclear structure organization.

Molecular Weight: 57 kDa (MW of target protein)