GRAMD2 antibody (Middle Region)

Catalog No. ABIN634882

This Rabbit Polyclonal antibody specifically detects GRAMD2 in WB. It exhibits reactivity toward Human.

Quick Overview for GRAMD2 antibody (Middle Region) (ABIN634882)

Target: GRAMD2 (GRAM Domain Containing 2 (GRAMD2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRAMD2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GRAMD2 Antibody

Binding Specificity: Middle Region

Specificity: GRAMD2 antibody was raised against the middle region of GRAMD2

Purification: Affinity purified

Immunogen: GRAMD2 antibody was raised using the middle region of GRAMD2 corresponding to a region with amino acids LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GRAMD2 Blocking Peptide, (ABIN5613850), is also available for use as a blocking control in assays to test for specificity of this GRAMD2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRAMD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRAMD2

Target: GRAMD2 (GRAM Domain Containing 2 (GRAMD2))

Alternative Name: GRAMD2

Background: The function of GRAMD2 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 40 kDa (MW of target protein)