CLN6 antibody (C-Term)

Catalog No. ABIN634889

The Rabbit Polyclonal anti-CLN6 antibody has been validated for WB. It is suitable to detect CLN6 in samples from Human, Mouse, Rat and Dog.

Quick Overview for CLN6 antibody (C-Term) (ABIN634889)

Target: CLN6 (Ceroid-Lipofuscinosis, Neuronal 6, Late Infantile, Variant (CLN6))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLN6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CLN6 Antibody

Binding Specificity: C-Term

Specificity: CLN6 antibody was raised against the C terminal of CLN6

Purification: Affinity purified

Immunogen: CLN6 antibody was raised using the C terminal of CLN6 corresponding to a region with amino acids RLFLDSNGLFLFSSFALTLLLVALWVAWLWNDPVLRKKYPGVIYVPEPWA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLN6 Blocking Peptide, (ABIN5612933), is also available for use as a blocking control in assays to test for specificity of this CLN6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLN6

Target: CLN6 (Ceroid-Lipofuscinosis, Neuronal 6, Late Infantile, Variant (CLN6))

Alternative Name: CLN6

Background: CLN6 is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely CLN6 involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.

Molecular Weight: 36 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process