ST8SIA6 antibody (Middle Region)

Catalog No. ABIN634897

This Rabbit Polyclonal antibody specifically detects ST8SIA6 in WB. It exhibits reactivity toward Human.

Quick Overview for ST8SIA6 antibody (Middle Region) (ABIN634897)

Target: ST8SIA6 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 6 (ST8SIA6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ST8SIA6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ST8SIA6 Antibody

Binding Specificity: Middle Region

Specificity: ST8 SIA6 antibody was raised against the middle region of ST8 IA6

Purification: Affinity purified

Immunogen: ST8 SIA6 antibody was raised using the middle region of ST8 IA6 corresponding to a region with amino acids LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ST8SIA6 Blocking Peptide, (ABIN940279), is also available for use as a blocking control in assays to test for specificity of this ST8SIA6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ST8SIA6

Target: ST8SIA6 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 6 (ST8SIA6))

Alternative Name: ST8SIA6

Background: Sialic acid is a key determinate of oligosaccharide structures involved in cell-cell communication, cell-substrate interaction, adhesion, and protein targeting.

Molecular Weight: 45 kDa (MW of target protein)