SLC43A1 antibody (Middle Region)

Catalog No. ABIN634904

The Rabbit Polyclonal anti-SLC43A1 antibody has been validated for WB. It is suitable to detect SLC43A1 in samples from Human.

Quick Overview for SLC43A1 antibody (Middle Region) (ABIN634904)

Target: SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC43A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC43A1 Antibody

Binding Specificity: Middle Region

Specificity: SLC43 A1 antibody was raised against the middle region of SLC43 1

Purification: Affinity purified

Immunogen: SLC43 A1 antibody was raised using the middle region of SLC43 1 corresponding to a region with amino acids AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC43A1 Blocking Peptide, (ABIN936994), is also available for use as a blocking control in assays to test for specificity of this SLC43A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC43A1

Target: SLC43A1 (Solute Carrier Family 43, Member 1 (SLC43A1))

Alternative Name: SLC43A1

Background: SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids.

Molecular Weight: 61 kDa (MW of target protein)