DNAJC25 antibody

Catalog No. ABIN634906

Product Details anti-DNAJC25 Antibody

Target: DNAJC25 (DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJC25 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DNAJC25 antibody was raised using a synthetic peptide corresponding to a region with amino acids RDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNAJC25 Blocking Peptide, catalog no. 33R-7841, is also available for use as a blocking control in assays to test for specificity of this DNAJC25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJC25

Target: DNAJC25 (DnaJ (Hsp40) Homolog, Subfamily C , Member 25 (DNAJC25))

Alternative Name: DNAJC25 (DNAJC25 Products)

Background: DNAJC25 may be involved in heat shock protein binding.

Molecular Weight: 42 kDa (MW of target protein)