Occludin antibody (N-Term)
-
- Target See all Occludin (OCLN) Antibodies
- Occludin (OCLN)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Occludin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Occludin antibody was raised against the N terminal of OCLN
- Purification
- Affinity purified
- Immunogen
- Occludin antibody was raised using the N terminal of OCLN corresponding to a region with amino acids VRPMLSQPAYSFYPEDEILHFYKWTSPPGVIRILSMLIIVMCIAIFACVA
- Top Product
- Discover our top product OCLN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Occludin Blocking Peptide, catalog no. 33R-9782, is also available for use as a blocking control in assays to test for specificity of this Occludin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCLN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Occludin (OCLN)
- Alternative Name
- Occludin (OCLN Products)
- Synonyms
- AI503564 antibody, Ocl antibody, ocln antibody, oclnb antibody, tpmt antibody, OCLN antibody, wu:fd23h10 antibody, wu:fi13c01 antibody, zgc:113992 antibody, zgc:56359 antibody, BLCPMG antibody, occludin antibody, occludin S homeolog antibody, occludin a antibody, Ocln antibody, OCLN antibody, ocln.S antibody, ocln antibody, oclna antibody
- Background
- OCLN is an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described. This gene encodes an integral membrane protein which is located at tight junctions. This protein may be involved in the formation and maintenance of the tight junction. The possibility of several alternatively spliced products has been suggested but the full nature of these products has not been described.
- Molecular Weight
- 59 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Hepatitis C
-