CLDND1 antibody (Middle Region)

Catalog No. ABIN634913

The Rabbit Polyclonal anti-CLDND1 antibody has been validated for WB. It is suitable to detect CLDND1 in samples from Human, Mouse and Rat.

Quick Overview for CLDND1 antibody (Middle Region) (ABIN634913)

Target: CLDND1 (Claudin Domain Containing 1 (CLDND1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLDND1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CLDND1 Antibody

Binding Specificity: Middle Region

Specificity: Claudin Domain Containing 1 antibody was raised against the middle region of CLDND1

Purification: Affinity purified

Immunogen: Claudin Domain Containing 1 antibody was raised using the middle region of CLDND1 corresponding to a region with amino acids TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin Domain Containing 1 Blocking Peptide, (ABIN5612911), is also available for use as a blocking control in assays to test for specificity of this Claudin Domain Containing 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDND1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLDND1

Target: CLDND1 (Claudin Domain Containing 1 (CLDND1))

Alternative Name: Claudin Domain Containing 1

Background: CLDND1 belongs to the PMP-22/EMP/MP20 family. The exact function of CLDND1 remains unknown.

Molecular Weight: 28 kDa (MW of target protein)