B3GALNT1 antibody

Catalog No. ABIN634919

Product Details anti-B3GALNT1 Antibody

Target: B3GALNT1 (beta-1,3-N-Acetylgalactosaminyltransferase 1 (B3GALNT1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B3GALNT1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: B3 GALNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

B3GALNT1 Blocking Peptide, catalog no. 33R-7328, is also available for use as a blocking control in assays to test for specificity of this B3GALNT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for B3GALNT1

Target: B3GALNT1 (beta-1,3-N-Acetylgalactosaminyltransferase 1 (B3GALNT1))

Alternative Name: B3GALNT1 (B3GALNT1 Products)

Synonyms: B3GALT3 antibody, B3galt3 antibody, b3GT3 antibody, GLCT3 antibody, GLOB antibody, Gb4Cer antibody, P antibody, P1 antibody, beta3Gal-T3 antibody, galT3 antibody, beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group) antibody, beta-1,3-N-acetylgalactosaminyltransferase 1 antibody, UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 1 antibody, B3GALNT1 antibody, B3galnt1 antibody

Background: This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. B3GALNT1 is type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates.

Molecular Weight: 39 kDa (MW of target protein)