Metaxin 1 antibody (C-Term)

Catalog No. ABIN634920

This anti-Metaxin 1 antibody is a Rabbit Polyclonal antibody detecting Metaxin 1 in WB. Suitable for Human and Mouse.

Quick Overview for Metaxin 1 antibody (C-Term) (ABIN634920)

Target: Metaxin 1 (MTX1)

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Metaxin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Metaxin 1 Antibody

Binding Specificity: C-Term

Specificity: Metaxin 1 antibody was raised against the C terminal of MTX1

Purification: Affinity purified

Immunogen: Metaxin 1 antibody was raised using the C terminal of MTX1 corresponding to a region with amino acids CLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Metaxin 1 Blocking Peptide, (ABIN937134), is also available for use as a blocking control in assays to test for specificity of this Metaxin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Metaxin 1

Target: Metaxin 1 (MTX1)

Alternative Name: Metaxin 1

Background: MTX1 belongs to the metaxin family. It is involved in transport of proteins into the mitochondrion and essential for embryonic development.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Dicarboxylic Acid Transport