Patched 2 antibody

Catalog No. ABIN634929

Product Details anti-Patched 2 Antibody

Target: Patched 2 (PTCH2)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Patched 2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PTCH2 Blocking Peptide, catalog no. 33R-4790, is also available for use as a blocking control in assays to test for specificity of this PTCH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTCH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Patched 2

Target: Patched 2 (PTCH2)

Alternative Name: PTCH2 (PTCH2 Products)

Synonyms: PTC2 antibody, ptc2 antibody, Ptch1 antibody, ptc-2 antibody, xptc-2 antibody, xptch-2 antibody, patched-2 antibody, ptch2 antibody, ptc-1 antibody, ptc1 antibody, ptch1 antibody, patched 2 antibody, patched 2 S homeolog antibody, patched 2 L homeolog antibody, PTCH2 antibody, Ptch2 antibody, ptch2.S antibody, ptch2.L antibody, ptch2 antibody

Background: PTCH2 is a member of the patched protein family. The patched protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. The gene encoding PTCH2 is shown to be mutated in a medulloblastoma and in a basal cell carcinoma, suggesting that it plays a role in the development of some tumors.

Molecular Weight: 130 kDa (MW of target protein)

Pathways: Hedgehog Signaling