MMP24 antibody
-
- Target See all MMP24 Antibodies
- MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MMP24 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- MMP24 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW
- Top Product
- Discover our top product MMP24 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MMP24 Blocking Peptide, catalog no. 33R-3551, is also available for use as a blocking control in assays to test for specificity of this MMP24 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP24 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))
- Alternative Name
- MMP24 (MMP24 Products)
- Background
- This protein activates MMP2 by cleavage. The gene has previously been referred to as MMP25 but has been renamed MMP24.
- Molecular Weight
- 57 kDa (MW of target protein)
-