MMP24 antibody

Catalog No. ABIN634930

This Rabbit Polyclonal antibody specifically detects MMP24 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MMP24 antibody (ABIN634930)

Target: MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP24 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MMP24 Antibody

Purification: Affinity purified

Immunogen: MMP24 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MMP24 Blocking Peptide, (ABIN938937), is also available for use as a blocking control in assays to test for specificity of this MMP24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MMP24

Target: MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))

Alternative Name: MMP24

Background: This protein activates MMP2 by cleavage. The gene has previously been referred to as MMP25 but has been renamed MMP24.

Molecular Weight: 57 kDa (MW of target protein)