MMP23B antibody (N-Term)

Catalog No. ABIN634931

The Rabbit Polyclonal anti-MMP23B antibody has been validated for WB. It is suitable to detect MMP23B in samples from Human and Dog.

Quick Overview for MMP23B antibody (N-Term) (ABIN634931)

Target: MMP23B (Matrix Metallopeptidase 23B (MMP23B))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP23B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MMP23B Antibody

Binding Specificity: N-Term

Specificity: MMP23 B antibody was raised against the N terminal of MMP23

Purification: Affinity purified

Immunogen: MMP23 B antibody was raised using the N terminal of MMP23 corresponding to a region with amino acids ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MMP23B Blocking Peptide, (ABIN939446), is also available for use as a blocking control in assays to test for specificity of this MMP23B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MMP23B

Target: MMP23B (Matrix Metallopeptidase 23B (MMP23B))

Alternative Name: MMP23B

Background: MMP23B is a member of the matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis.

Molecular Weight: 36 kDa (MW of target protein)