SPATA9 antibody (N-Term)

Catalog No. ABIN634932

This anti-SPATA9 antibody is a Rabbit Polyclonal antibody detecting SPATA9 in WB. Suitable for Human.

Quick Overview for SPATA9 antibody (N-Term) (ABIN634932)

Target: SPATA9 (Spermatogenesis Associated 9 (SPATA9))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPATA9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SPATA9 Antibody

Binding Specificity: N-Term

Specificity: SPATA9 antibody was raised against the N terminal of SPATA9

Purification: Affinity purified

Immunogen: SPATA9 antibody was raised using the N terminal of SPATA9 corresponding to a region with amino acids PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPATA9 Blocking Peptide, (ABIN5616364), is also available for use as a blocking control in assays to test for specificity of this SPATA9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPATA9

Target: SPATA9 (Spermatogenesis Associated 9 (SPATA9))

Alternative Name: SPATA9

Background: SPATA9 may play a role in testicular development/spermatogenesis and may be an important factor in male infertility. Defects in expression of SPATA9 lead to Sertoli-cell-only syndrome.

Molecular Weight: 29 kDa (MW of target protein)