CMTM8 antibody (Middle Region)

Catalog No. ABIN634936

Product Details anti-CMTM8 Antibody

Target: CMTM8 (CKLF-Like MARVEL Transmembrane Domain Containing 8 (CMTM8))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CMTM8 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CMTM8 antibody was raised against the middle region of CMTM8

Purification: Affinity purified

Immunogen: CMTM8 antibody was raised using the middle region of CMTM8 corresponding to a region with amino acids CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CMTM8 Blocking Peptide, catalog no. 33R-1686, is also available for use as a blocking control in assays to test for specificity of this CMTM8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CMTM8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CMTM8

Target: CMTM8 (CKLF-Like MARVEL Transmembrane Domain Containing 8 (CMTM8))

Alternative Name: CMTM8 (CMTM8 Products)

Synonyms: MGC82744 antibody, marveld1 antibody, CKLFSF8 antibody, CKLFSF8-V2 antibody, 2700018N07Rik antibody, AA408515 antibody, Cklfsf8 antibody, CKLF-like MARVEL transmembrane domain containing 8 L homeolog antibody, CKLF like MARVEL transmembrane domain containing 8 antibody, CKLF-like MARVEL transmembrane domain containing 8 antibody, cmtm8.L antibody, CMTM8 antibody, cmtm8 antibody, Cmtm8 antibody

Background: Cmtm8 gene belongs to the chemokine-like factor geneuperfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. This gene belongs to the chemokine-like factor geneuperfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.

Molecular Weight: 19 kDa (MW of target protein)