POMT2 antibody (Middle Region)

Catalog No. ABIN634940

The Rabbit Polyclonal anti-POMT2 antibody is suitable to detect POMT2 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for POMT2 antibody (Middle Region) (ABIN634940)

Target: POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POMT2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-POMT2 Antibody

Binding Specificity: Middle Region

Specificity: POMT2 antibody was raised against the middle region of POMT2

Purification: Affinity purified

Immunogen: POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POMT2 Blocking Peptide, (ABIN5615470), is also available for use as a blocking control in assays to test for specificity of this POMT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POMT2

Target: POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))

Alternative Name: POMT2

Background: POMT2 encodes an integral membrane protein of the endoplasmic reticulum (ER) that shares significant sequence similarity with a family of protein O-mannosyltransferases of S.cerevisiae.

Molecular Weight: 84 kDa (MW of target protein)