TMEM30A antibody (N-Term)

Catalog No. ABIN634944

This anti-TMEM30A antibody is a Rabbit Polyclonal antibody detecting TMEM30A in WB and IHC. Suitable for Human, Mouse, Rat, Dog and Zebrafish (Danio rerio).

Quick Overview for TMEM30A antibody (N-Term) (ABIN634944)

Target: TMEM30A (Transmembrane Protein 30A (TMEM30A))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM30A antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-TMEM30A Antibody

Binding Specificity: N-Term

Specificity: TMEM30 A antibody was raised against the N terminal of TMEM30

Purification: Affinity purified

Immunogen: TMEM30 A antibody was raised using the N terminal of TMEM30 corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM30A Blocking Peptide, (ABIN938480), is also available for use as a blocking control in assays to test for specificity of this TMEM30A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM30A

Target: TMEM30A (Transmembrane Protein 30A (TMEM30A))

Alternative Name: TMEM30A

Background: The function of TMEM30A protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 41 kDa (MW of target protein)