POPDC3 antibody (C-Term)

Catalog No. ABIN634947

This anti-POPDC3 antibody is a Rabbit Polyclonal antibody detecting POPDC3 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for POPDC3 antibody (C-Term) (ABIN634947)

Target: POPDC3 (Popeye Domain Containing 3 (POPDC3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This POPDC3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-POPDC3 Antibody

Binding Specificity: C-Term

Specificity: POPDC3 antibody was raised against the C terminal of POPDC3

Purification: Affinity purified

Immunogen: POPDC3 antibody was raised using the C terminal of POPDC3 corresponding to a region with amino acids YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

POPDC3 Blocking Peptide, (ABIN936143), is also available for use as a blocking control in assays to test for specificity of this POPDC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POPDC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for POPDC3

Target: POPDC3 (Popeye Domain Containing 3 (POPDC3))

Alternative Name: POPDC3

Background: POPDC3 is a member of the POP family of proteins containing three putative transmembrane domains. The protein is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development.

Molecular Weight: 34 kDa (MW of target protein)