GTPase, IMAP Family Member 1 (GIMAP1) (N-Term) antibody

Catalog No. ABIN634959

This anti- antibody is a Rabbit Polyclonal antibody detecting in WB. Suitable for Human.

Quick Overview for GTPase, IMAP Family Member 1 (GIMAP1) (N-Term) antibody (ABIN634959)

Target: GTPase, IMAP Family Member 1 (GIMAP1)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: GIMAP1 antibody was raised against the N terminal of GIMAP1

Purification: Affinity purified

Immunogen: GIMAP1 antibody was raised using the N terminal of GIMAP1 corresponding to a region with amino acids MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQ

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GIMAP1 Blocking Peptide, (ABIN5613761), is also available for use as a blocking control in assays to test for specificity of this GIMAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIMAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: GTPase, IMAP Family Member 1 (GIMAP1)

Alternative Name: GIMAP1

Background: GIMAP1 belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins.

Molecular Weight: 34 kDa (MW of target protein)