NrCAM antibody (N-Term)

Catalog No. ABIN634961

The Rabbit Polyclonal anti-NrCAM antibody is suitable to detect NrCAM in samples from Human, Mouse, Rat, Dog and Zebrafish (Danio rerio). It has been validated for WB.

Quick Overview for NrCAM antibody (N-Term) (ABIN634961)

Target: NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NrCAM antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NrCAM Antibody

Binding Specificity: N-Term

Specificity: NRCAM antibody was raised against the N terminal of NRCAM

Purification: Affinity purified

Immunogen: NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NRCAM Blocking Peptide, (ABIN5615061), is also available for use as a blocking control in assays to test for specificity of this NRCAM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRCAM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NrCAM

Target: NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))

Alternative Name: NRCAM

Background: Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.

Molecular Weight: 84 kDa (MW of target protein)

Pathways: Regulation of Cell Size