NrCAM antibody (N-Term)
-
- Target See all NrCAM (NRCAM) Antibodies
- NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))
-
Binding Specificity
- N-Term
-
Reactivity
- Mouse, Human, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NrCAM antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NRCAM antibody was raised against the N terminal of NRCAM
- Purification
- Affinity purified
- Immunogen
- NRCAM antibody was raised using the N terminal of NRCAM corresponding to a region with amino acids PLILFLCQMISALEVPLDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGK
- Top Product
- Discover our top product NRCAM Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NRCAM Blocking Peptide, catalog no. 33R-7194, is also available for use as a blocking control in assays to test for specificity of this NRCAM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRCAM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NrCAM (NRCAM) (Neuronal Cell Adhesion Molecule (NRCAM))
- Alternative Name
- NRCAM (NRCAM Products)
- Synonyms
- CD56 antibody, MSK39 antibody, NCAM antibody, Bravo antibody, C030017F07Rik antibody, C130076O07Rik antibody, mKIAA0343 antibody, NRCAM antibody, si:dkey-240a12.1 antibody, Nr-CAM antibody, neural cell adhesion molecule 1 antibody, neuronal cell adhesion molecule antibody, neuronal cell adhesion molecule L homeolog antibody, neuronal cell adhesion molecule a antibody, NCAM1 antibody, NRCAM antibody, Nrcam antibody, nrcam.L antibody, nrcama antibody, nrcam antibody
- Background
- Cell adhesion molecules (CAMs) are members of the immunoglobulin superfamily. NRCAM is a neuronal cell adhesion molecule with multiple immunoglobulin-like C2-type domains and fibronectin type-III domains. This ankyrin-binding protein is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM may also play a general role in cell-cell communication via signaling from its intracellular domain to the actin cytoskeleton during directional cell migration. Allelic variants of its gene have been associated with autism and addiction vulnerability.
- Molecular Weight
- 84 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-