STYK1 antibody (C-Term)

Catalog No. ABIN634962

This anti-STYK1 antibody is a Rabbit Polyclonal antibody detecting STYK1 in WB. Suitable for Human, Mouse, Rat and Dog.

Quick Overview for STYK1 antibody (C-Term) (ABIN634962)

Target: STYK1 (serine/threonine/tyrosine Kinase 1 (STYK1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This STYK1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-STYK1 Antibody

Binding Specificity: C-Term

Specificity: STYK1 antibody was raised against the C terminal of STYK1

Purification: Affinity purified

Immunogen: STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKI

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

STYK1 Blocking Peptide, (ABIN5616453), is also available for use as a blocking control in assays to test for specificity of this STYK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STYK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for STYK1

Target: STYK1 (serine/threonine/tyrosine Kinase 1 (STYK1))

Alternative Name: STYK1

Background: Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival.

Molecular Weight: 47 kDa (MW of target protein)