LRRC8A antibody (N-Term)

Catalog No. ABIN634965

Product Details anti-LRRC8A Antibody

Target: LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC8A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LRRC8 A antibody was raised against the N terminal of LRRC8

Purification: Affinity purified

Immunogen: LRRC8 A antibody was raised using the N terminal of LRRC8 corresponding to a region with amino acids IPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC8A Blocking Peptide, catalog no. 33R-4105, is also available for use as a blocking control in assays to test for specificity of this LRRC8A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC8A

Target: LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A))

Alternative Name: LRRC8A (LRRC8A Products)

Background: LRRC8A is a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. LRRC8A is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation.

Molecular Weight: 94 kDa (MW of target protein)