LRRC8A antibody (N-Term)
-
- Target See all LRRC8A Antibodies
- LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRRC8A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LRRC8 A antibody was raised against the N terminal of LRRC8
- Purification
- Affinity purified
- Immunogen
- LRRC8 A antibody was raised using the N terminal of LRRC8 corresponding to a region with amino acids IPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDK
- Top Product
- Discover our top product LRRC8A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRRC8A Blocking Peptide, catalog no. 33R-4105, is also available for use as a blocking control in assays to test for specificity of this LRRC8A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A))
- Alternative Name
- LRRC8A (LRRC8A Products)
- Background
- LRRC8A is a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. LRRC8A is a putative four-pass transmembrane protein that plays a role in B cell development. Defects in this gene cause autosomal dominant non-Bruton type agammaglobulinemia, an immunodeficiency disease resulting from defects in B cell maturation.
- Molecular Weight
- 94 kDa (MW of target protein)
-