MARVELD3 antibody (Middle Region)
-
- Target See all MARVELD3 Antibodies
- MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MARVELD3 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- MARVELD3 antibody was raised against the middle region of MARVELD3
- Purification
- Affinity purified
- Immunogen
- MARVELD3 antibody was raised using the middle region of MARVELD3 corresponding to a region with amino acids SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY
- Top Product
- Discover our top product MARVELD3 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MARVELD3 Blocking Peptide, catalog no. 33R-8948, is also available for use as a blocking control in assays to test for specificity of this MARVELD3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))
- Alternative Name
- MARVELD3 (MARVELD3 Products)
- Synonyms
- 1810006A16Rik antibody, AI642133 antibody, Marvd3 antibody, Mrvldc3 antibody, MARVD3 antibody, MRVLDC3 antibody, RGD1562056 antibody, MARVEL (membrane-associating) domain containing 3 antibody, MARVEL domain containing 3 antibody, Marveld3 antibody, MARVELD3 antibody
- Background
- MARVELD3 is involved in membrane apposition and fusion events.
- Molecular Weight
- 46 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-