MARVELD3 antibody (Middle Region)

Catalog No. ABIN634967

Product Details anti-MARVELD3 Antibody

Target: MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MARVELD3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: MARVELD3 antibody was raised against the middle region of MARVELD3

Purification: Affinity purified

Immunogen: MARVELD3 antibody was raised using the middle region of MARVELD3 corresponding to a region with amino acids SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MARVELD3 Blocking Peptide, catalog no. 33R-8948, is also available for use as a blocking control in assays to test for specificity of this MARVELD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MARVELD3

Target: MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))

Alternative Name: MARVELD3 (MARVELD3 Products)

Synonyms: 1810006A16Rik antibody, AI642133 antibody, Marvd3 antibody, Mrvldc3 antibody, MARVD3 antibody, MRVLDC3 antibody, RGD1562056 antibody, MARVEL (membrane-associating) domain containing 3 antibody, MARVEL domain containing 3 antibody, Marveld3 antibody, MARVELD3 antibody

Background: MARVELD3 is involved in membrane apposition and fusion events.

Molecular Weight: 46 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization