TREML2 antibody (Middle Region)

Catalog No. ABIN634968

The Rabbit Polyclonal anti-TREML2 antibody (ABIN634968) specifically detects TREML2 in WB. The antibody is reactive with Human samples.

Quick Overview for TREML2 antibody (Middle Region) (ABIN634968)

Target: TREML2 (Triggering Receptor Expressed On Myeloid Cells-Like 2 (TREML2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TREML2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TREML2 Antibody

Binding Specificity: Middle Region

Specificity: TREML2 antibody was raised against the middle region of TREML2

Purification: Affinity purified

Immunogen: TREML2 antibody was raised using the middle region of TREML2 corresponding to a region with amino acids TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TREML2 Blocking Peptide, (ABIN5616771), is also available for use as a blocking control in assays to test for specificity of this TREML2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TREML2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TREML2

Target: TREML2 (Triggering Receptor Expressed On Myeloid Cells-Like 2 (TREML2))

Alternative Name: TREML2

Background: TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. TREML2 is a cell surface receptor that may play a role in the innate and adaptive immune response. TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 and TREM2, but it has distinct structural and functional properties.

Molecular Weight: 41 kDa (MW of target protein)