FAM19A3 antibody (Middle Region)

Catalog No. ABIN634975

This Rabbit Polyclonal antibody specifically detects FAM19A3 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for FAM19A3 antibody (Middle Region) (ABIN634975)

Target: FAM19A3 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A3 (FAM19A3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM19A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM19A3 Antibody

Binding Specificity: Middle Region

Specificity: FAM19 A3 antibody was raised against the middle region of FAM19 3

Purification: Affinity purified

Immunogen: FAM19 A3 antibody was raised using the middle region of FAM19 3 corresponding to a region with amino acids FSGQVAGTTRAKPSCVDDLLLAAHCARRDPRAALRLLLPQPPSSCRDGGV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM19A3 Blocking Peptide, (ABIN938444), is also available for use as a blocking control in assays to test for specificity of this FAM19A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM10 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM19A3

Target: FAM19A3 (Family with Sequence Similarity 19 (Chemokine (C-C Motif)-Like), Member A3 (FAM19A3))

Alternative Name: FAM19A3

Background: FAM19A3 is a member of the TAFA family which is composed of five highly homologous small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells.

Molecular Weight: 18 kDa (MW of target protein)