CKLF antibody (N-Term)

Catalog No. ABIN634980

This anti-CKLF antibody is a Rabbit Polyclonal antibody detecting CKLF in WB. Suitable for Human.

Quick Overview for CKLF antibody (N-Term) (ABIN634980)

Target: CKLF (Chemokine-Like Factor (CKLF))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CKLF antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CKLF Antibody

Binding Specificity: N-Term

Specificity: CKLF antibody was raised against the N terminal of CKLF

Purification: Affinity purified

Immunogen: CKLF antibody was raised using the N terminal of CKLF corresponding to a region with amino acids MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CKLF Blocking Peptide, (ABIN5612902), is also available for use as a blocking control in assays to test for specificity of this CKLF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKLF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CKLF

Target: CKLF (Chemokine-Like Factor (CKLF))

Alternative Name: CKLF

Background: CKLF is a cytokine. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. CKLF is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle.

Molecular Weight: 13 kDa (MW of target protein)