VSIG8 antibody (N-Term)

Catalog No. ABIN634989

This anti-VSIG8 antibody is a Rabbit Polyclonal antibody detecting VSIG8 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for VSIG8 antibody (N-Term) (ABIN634989)

Target: VSIG8 (V-Set and Immunoglobulin Domain Containing 8 (VSIG8))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VSIG8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-VSIG8 Antibody

Binding Specificity: N-Term

Specificity: VSIG8 antibody was raised against the N terminal of VSIG8

Purification: Affinity purified

Immunogen: VSIG8 antibody was raised using the N terminal of VSIG8 corresponding to a region with amino acids HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VSIG8 Blocking Peptide, (ABIN939224), is also available for use as a blocking control in assays to test for specificity of this VSIG8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VSIG8

Target: VSIG8 (V-Set and Immunoglobulin Domain Containing 8 (VSIG8))

Alternative Name: VSIG8

Background: VSIG8 contains 2 Ig-like V-type (immunoglobulin-like) domains. VSIG8 is single-pass type I membrane protein. The function of the VSIG8 protein remains unknown.

Molecular Weight: 44 kDa (MW of target protein)