Slc26a9 antibody (Middle Region)

Catalog No. ABIN634992

This anti-Slc26a9 antibody is a Rabbit Polyclonal antibody detecting Slc26a9 in WB. Suitable for Human.

Quick Overview for Slc26a9 antibody (Middle Region) (ABIN634992)

Target: Slc26a9 (Solute Carrier Family 26, Member 9 (Slc26a9))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Slc26a9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Slc26a9 Antibody

Binding Specificity: Middle Region

Specificity: SLC26 A9 antibody was raised against the middle region of SLC26 9

Purification: Affinity purified

Immunogen: SLC26 A9 antibody was raised using the middle region of SLC26 9 corresponding to a region with amino acids LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC26A9 Blocking Peptide, (ABIN940167), is also available for use as a blocking control in assays to test for specificity of this SLC26A9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Slc26a9

Target: Slc26a9 (Solute Carrier Family 26, Member 9 (Slc26a9))

Alternative Name: SLC26A9

Background: This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns.

Molecular Weight: 87 kDa (MW of target protein)