Slc26a9 antibody (Middle Region)
-
- Target See all Slc26a9 Antibodies
- Slc26a9 (Solute Carrier Family 26, Member 9 (Slc26a9))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Slc26a9 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC26 A9 antibody was raised against the middle region of SLC26 9
- Purification
- Affinity purified
- Immunogen
- SLC26 A9 antibody was raised using the middle region of SLC26 9 corresponding to a region with amino acids LAKLSSTYGKIGVKVFLVNIHAQVYNDISHGGVFEDGSLECKHVFPSIHD
- Top Product
- Discover our top product Slc26a9 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC26A9 Blocking Peptide, catalog no. 33R-4781, is also available for use as a blocking control in assays to test for specificity of this SLC26A9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Slc26a9 (Solute Carrier Family 26, Member 9 (Slc26a9))
- Alternative Name
- SLC26A9 (Slc26a9 Products)
- Background
- This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns.
- Molecular Weight
- 87 kDa (MW of target protein)
-