C14orf180 antibody (Middle Region)

Catalog No. ABIN635001

This anti-C14orf180 antibody is a Rabbit Polyclonal antibody detecting C14orf180 in WB. Suitable for Human.

Quick Overview for C14orf180 antibody (Middle Region) (ABIN635001)

Target: C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C14orf180 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C14orf180 Antibody

Binding Specificity: Middle Region

Specificity: C14 ORF180 antibody was raised against the middle region of C14 rf180

Purification: Affinity purified

Immunogen: C14 ORF180 antibody was raised using the middle region of C14 rf180 corresponding to a region with amino acids PPAVTVHYIADKNATATVRVPGRPRPHGGSLLLQLCVCVLLVLALGLYCG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C14ORF180 Blocking Peptide, (ABIN5612412), is also available for use as a blocking control in assays to test for specificity of this C14ORF180 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF180 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C14orf180

Target: C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))

Alternative Name: C14ORF180

Background: C14orf180 is a multi-pass membrane protein. The function of the C14orf180 protein is not known.

Molecular Weight: 18 kDa (MW of target protein)