TM7SF2 antibody (N-Term)

Catalog No. ABIN635009

The Rabbit Polyclonal anti-TM7SF2 antibody has been validated for WB. It is suitable to detect TM7SF2 in samples from Human.

Quick Overview for TM7SF2 antibody (N-Term) (ABIN635009)

Target: TM7SF2 (Transmembrane 7 Superfamily Member 2 (TM7SF2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TM7SF2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TM7SF2 Antibody

Binding Specificity: N-Term

Specificity: TM7 SF2 antibody was raised against the N terminal of TM7 F2

Purification: Affinity purified

Immunogen: TM7 SF2 antibody was raised using the N terminal of TM7 F2 corresponding to a region with amino acids LAARSGPARLLGPPASLPGLEVLWSPRALLLWLAWLGLQAALYLLPARKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TM7SF2 Blocking Peptide, (ABIN940143), is also available for use as a blocking control in assays to test for specificity of this TM7SF2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TM7SF2

Target: TM7SF2 (Transmembrane 7 Superfamily Member 2 (TM7SF2))

Alternative Name: TM7SF2

Background: TM7SF2 is involved in the conversion of lanosterol to cholesterol.

Molecular Weight: 46 kDa (MW of target protein)