SLC32A1 antibody

Catalog No. ABIN635012

The Rabbit Polyclonal anti-SLC32A1 antibody has been validated for WB. It is suitable to detect SLC32A1 in samples from Human.

Quick Overview for SLC32A1 antibody (ABIN635012)

Target: SLC32A1 (Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC32A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC32A1 Antibody

Purification: Affinity purified

Immunogen: SLC32 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC32A1 Blocking Peptide, (ABIN938582), is also available for use as a blocking control in assays to test for specificity of this SLC32A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC32A1

Target: SLC32A1 (Solute Carrier Family 32 (GABA Vesicular Transporter), Member 1 (SLC32A1))

Alternative Name: SLC32A1

Background: SLC32A1 is involved in the uptake of GABA and glycine into the synaptic vesicles.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Proton Transport