TMEM30B antibody (Middle Region)

Catalog No. ABIN635017

This Rabbit Polyclonal antibody specifically detects TMEM30B in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TMEM30B antibody (Middle Region) (ABIN635017)

Target: TMEM30B (Transmembrane Protein 30B (TMEM30B))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM30B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMEM30B Antibody

Binding Specificity: Middle Region

Specificity: TMEM30 B antibody was raised against the middle region of TMEM30

Purification: Affinity purified

Immunogen: TMEM30 B antibody was raised using the middle region of TMEM30 corresponding to a region with amino acids VYLYYELTNFYQNNRRYGVSRDDAQLSGLPSALRHPVNECAPYQRSAAGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM30B Blocking Peptide, (ABIN5616677), is also available for use as a blocking control in assays to test for specificity of this TMEM30B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM30B

Target: TMEM30B (Transmembrane Protein 30B (TMEM30B))

Alternative Name: TMEM30B

Background: TMEM30B belongs to the CDC50/LEM3 family. It is a multi-pass membrane protein. The function of the TMEM30B protein remains unknown.

Molecular Weight: 39 kDa (MW of target protein)