ERGIC3 antibody (C-Term)

Catalog No. ABIN635020

This Rabbit Polyclonal antibody specifically detects ERGIC3 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ERGIC3 antibody (C-Term) (ABIN635020)

Target: ERGIC3 (ERGIC and Golgi 3 (ERGIC3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ERGIC3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ERGIC3 Antibody

Binding Specificity: C-Term

Specificity: ERGIC3 antibody was raised against the C terminal of ERGIC3

Purification: Affinity purified

Immunogen: ERGIC3 antibody was raised using the C terminal of ERGIC3 corresponding to a region with amino acids LTEKHRSFTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ERGIC3 Blocking Peptide, (ABIN5613395), is also available for use as a blocking control in assays to test for specificity of this ERGIC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERGIC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ERGIC3

Target: ERGIC3 (ERGIC and Golgi 3 (ERGIC3))

Alternative Name: ERGIC3

Background: ERGIC3 plays a possible role in transport between endoplasmic reticulum and Golgi.

Molecular Weight: 43 kDa (MW of target protein)