LRRC8A antibody (Middle Region)

Catalog No. ABIN635022

This anti-LRRC8A antibody is a Rabbit Polyclonal antibody detecting LRRC8A in WB. Suitable for Human.

Quick Overview for LRRC8A antibody (Middle Region) (ABIN635022)

Target: LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC8A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRRC8A Antibody

Binding Specificity: Middle Region

Specificity: LRRC8 A antibody was raised against the middle region of LRRC8

Purification: Affinity purified

Immunogen: LRRC8 A antibody was raised using the middle region of LRRC8 corresponding to a region with amino acids NLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC8A Blocking Peptide, (ABIN5614587), is also available for use as a blocking control in assays to test for specificity of this LRRC8A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC8A

Target: LRRC8A (Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A))

Alternative Name: LRRC8A

Background: LRRC8A is a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions.

Molecular Weight: 94 kDa (MW of target protein)