ELOVL5 antibody

Catalog No. ABIN635023

This Rabbit Polyclonal antibody specifically detects ELOVL5 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for ELOVL5 antibody (ABIN635023)

Target: ELOVL5 (ELOVL Fatty Acid Elongase 5 (ELOVL5))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ELOVL5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ELOVL5 Antibody

Purification: Affinity purified

Immunogen: ELOVL5 antibody was raised using a synthetic peptide corresponding to a region with amino acids EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ELOVL5 Blocking Peptide, (ABIN937837), is also available for use as a blocking control in assays to test for specificity of this ELOVL5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELOVL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ELOVL5

Target: ELOVL5 (ELOVL Fatty Acid Elongase 5 (ELOVL5))

Alternative Name: ELOVL5

Background: ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.

Molecular Weight: 35 kDa (MW of target protein)